General Information

  • ID:  hor005788
  • Uniprot ID:  P11159
  • Protein name:  Diapause hormone homolog
  • Gene name:  NA
  • Organism:  Helicoverpa zea (Corn earworm moth) (Heliothis zea)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  Expressed in the subesophageal ganglions. Not found in corpora cardiaca, corpora allata and thoracic ganglia.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Helicoverpa (genus), Heliothinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0019236 response to pheromone; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NDVKDGAASGAHSDRLGLWFGPRL
  • Length:  24(24-47)
  • Propeptide:  MFNQTQLFVFLAVFTTSSVLGNNNDVKDGAASGAHSDRLGLWFGPRLGKRSLRISTEDNRQAFFKLLEAADALKYYYDQLPYEMQADEPETRVTKKVIFTPKLGRSLAYDDKSFENVEFTPRLGRRLSDDMPATPADQEMYRQDPEQIDSRTKYFSPRLGRTMNFSPRLGRELSYDMMPNKIRVVRSTNKTRST
  • Signal peptide:  MFNQTQLFVFLAVFTTSSVLGNN
  • Modification:  T24 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  A hormone that controls sex pheromone production in females and pheromone responsiveness in male. Also mediates visceral muscle contractile activity (myotropic activity).
  • Mechanism:  Juvenile hormone seems to allow PBAN release, which then induces pheromone biosynthesis.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11159-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005788_AF2.pdbhor005788_ESM.pdb

Physical Information

Mass: 295024 Formula: C111H171N35O34
Absent amino acids: CEIMQTY Common amino acids: G
pI: 7.55 Basic residues: 4
Polar residues: 7 Hydrophobic residues: 9
Hydrophobicity: -50 Boman Index: -4635
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 73.33
Instability Index: 135.42 Extinction Coefficient cystines: 5500
Absorbance 280nm: 239.13

Literature

  • PubMed ID:  8022813
  • Title:  Structural organization of the Helicoverpa zea gene encoding the precursor protein for pheromone biosynthesis-activating neuropeptide and other neuropeptides.
  • PubMed ID:  17802237
  • Title:  Identification of a neuropeptide hormone that regulates sex pheromone production in female moth
  • PubMed ID:  8791159
  • Title: